Retailer Plastic Nail With Cover For Bag Parts JW D005

Price US $0.01-0.02. Minimum Order 5000 Sets. Location China (Mainland). Company Fujian Quanzhou Jianwei Plastic Products Co., Ltd.. Response Rate . Type Other Decoration Accessory. Material Plastic,POM. Model Number Bubble Nail Cushion. Brand Name JIANWEI. Place Of Origin Fujian,China (Mainland). Size 19*10


USD 0.01USD 0.01
Product Details

More details about this product

Price : US $0.01-0.02
Minimum Order : 5000 Sets
Location : China (Mainland)
Company : Fujian Quanzhou Jianwei Plastic Products Co., Ltd.
Response Rate :
Type : Other Decoration Accessory
Material : Plastic,POM
Model Number : Bubble Nail Cushion
Brand Name : JIANWEI
Place Of Origin : Fujian,China (Mainland)
Size : 19*10
Related Products
High Quality USP 39/EP 9.0 /BP 2012 GMP DMF FDA Peptide YY (3 36) Human CAS 123583 37 9 Producer

Price US $0.01-0.1. Minimum Order 1 Gram. Location China (Mainland). Company Shaanxi Dideu Medichem Co. Ltd. Response Rate . Mf C180H279N53O54. Other Names IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2. Purity 99.9%. Type Antibiotic and Antimicrobial Agents. Grade Standard Medicine Grade. E Coli Absent

USD 0.01
China Supplier High Purity Hydroquinone In Chemicals

Price US $20-30. Minimum Order 25 Kilograms. Location China (Mainland). Company Hangzhou Lingeba Technology Co., Ltd.. Response Rate 75.6%. Mf C6H6O2. Other Names 1,4-Benzenediol (hydroquinone). Appearance White fine power. Application Raw Material,cosmetics,pharm. Purity 98.5%. Type Pharmaceutical Intermediates,Cosmetic Raw Material

USD 20.00
Hydroquinone Powder 99% 123 31 9 Hydroquinone Products

Price US $10-30. Minimum Order 1 Kilogram. Location China (Mainland). Company Taian Health Chemical Co., Ltd.. Response Rate 80.2%. Mf C6H6O2. Other Names Quinol; 1,4-Benzenediol; 1,4-Dihydroxybenzene. Appearance White powder. Application Pharmaceutical Intermediates. Purity 99%. Type Agrochemical Intermediates,Dyestuff Intermediates,Flavor & Fragrance Intermediates,Pharmaceutical Intermediates,Syntheses Material Intermediates

USD 10.00
Hydroquinone Powder 99% 123 31 9 Hydroquinone Price

Price US $6900-7800. Minimum Order 1 Metric Ton. Location China (Mainland). Company Zouping Changshan Town Zefeng Fertilizer Factory. Response Rate 56.2%. Mf C6H6O2. Other Names quinol,1,4-benzenediol. Appearance white powder. Application Generally for photograph, dye, pesticide rubber, che. Purity 99.9%. Type Agrochemical Intermediates,Dyestuff Intermediates,Flavor & Fragrance Intermediates,Pharmaceutical Intermediates,Syntheses Material Intermediates

USD 6,900.00
Pure Hydroquinone Powder HQ 123 31 9 Photo Grade

Price US $15-30. Minimum Order 1 Kilogram. Location China (Mainland). Company Shanghai Sungo Technology&Trade Co., Ltd.. Response Rate 63.9%. Mf C6H6O2. Other Names HQ, 4-Benzenediol. Appearance White powder. Application Pharm Intermediates. Purity 99%. Type Dyestuff Intermediates,Pharmaceutical Intermediates,Syntheses Material Intermediates

USD 15.00
High Purity Hydroquinone CAS:123 31 9 With 99.9% Min

Price US $1-20. Minimum Order 1 Kilogram. Location China (Mainland). Company Tai'an City Zhi Shang Economy And Trade Co., Ltd.. Response Rate . Mf C6H6O2. Other Name 1,4-Benzenediol (hydroquinone). Other Names 1,4-Benzenediol (hydroquinone). Appearance White Powder. Application Used. Purity 99%min

USD 1.00
Mono Tert Butylhydroquinone

Price . Minimum Order 450 Kilograms. Location India. Company NOVA INTERNATIONAL. Response Rate . Other Names TBHQ. Type Antioxidants,Preservatives. Mf C10H14O2. Place Of Origin Gujarat,India. Cas No 1948-33-0. Brand Name N.A.

USD 0.00
Noradrenaline Bitartrate With FDA

Price . Minimum Order 1 Kilogram. Location China (Mainland). Company Novachem (Wuhan) Import & Export Company Ltd.. Response Rate 77.1%. Mf C8H11NO3.C4H6O6.H2O. Other Names L-4-(2-Amino-1-hydroxyethyl)-1,2-benzenediol bitartrate. Purity 95%-105%. Type Antibiotic and Antimicrobial Agents. Grade Standard Medicine Grade. Place Of Origin Hubei,China (Mainland)

USD 0.00
High Quality 99% USP/BP/EP Epinephrine Hydrochloride

Price US $4-10. Minimum Order 1 Kilogram. Location China (Mainland). Company Qingdao Fraken International Trading Co., Ltd.. Response Rate 79.2%. Mf C9H14ClNO3. Other Name (R)-4-(1-Hydroxy-2-(methylamino)ethyl)-1,2-benzenediol hydrochloride. Other Names Epinephrine HCL. Purity 99%. Type Antiparasitic Agents. Grade Standard Medicine Grade,Tech Grade

USD 4.00
  • follow us on